PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G1863
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 207aa    MW: 23359.6 Da    PI: 8.4622
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G1863genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++ +G+g +W + ++++g++R++k+c++rw++yl
      Gh_A06G1863 14 KGPWSPEEDAKLKAYIEHYGTGgNWISLPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding40.18.4e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEde++  +    G++ W+ Ia+ ++ gRt++++k++w++
      Gh_A06G1863  69 GGFSEEEDEIICSLYLSIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.275962IPR017930Myb domain
SuperFamilySSF466891.72E-2711109IPR009057Homeodomain-like
SMARTSM007171.3E-121364IPR001005SANT/Myb domain
PfamPF002492.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-251569IPR009057Homeodomain-like
CDDcd001676.70E-101662No hitNo description
PROSITE profilePS5129421.74763117IPR017930Myb domain
SMARTSM007175.9E-1167115IPR001005SANT/Myb domain
PfamPF002493.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2470117IPR009057Homeodomain-like
CDDcd001673.32E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKAYIE HYGTGGNWIS LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDEIIC SLYLSIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
YPRPEPPFPV VPVPYSSQGQ SIQFTNSQCS VVDGANMEQH MLQGQTSSSS LNGMGLFYGE  180
DIINDTSSLV CFGMFQHYAF YDHISLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26141177108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0527240.0KM052724.1 Gossypium hirsutum RAX-like transcription factor RAX5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449046.11e-138PREDICTED: transcription factor RAX3-like
SwissprotQ9M2Y95e-81RAX3_ARATH; Transcription factor RAX3
SwissprotQ9FKL27e-81MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A089NBF51e-138A0A089NBF5_G
TrEMBLA0A0D2V4U31e-138A0A0D2V4U3_G
STRINGGSMUA_Achr5P22760_0017e-81(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-82myb domain protein 36